RAB11A antibody orb334521 from Biorbyt

Product Specs
ItemRAB11A antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb334521
Quantity10 µg, 100 µg
ApplicationsWB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetRAB11A
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences
NCBI Full Gene NameRAB11A, member RAS oncogene family
NCBI Gene AliasesYL8
ClonalityPolyclonal
Molecular Weight24394 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat

Add to Compare List